SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016169 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016169
Domain Number 1 Region: 351-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-32
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 576-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-27
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 799-1001
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-25
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 1185-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000915
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 5 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000124
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 6 Region: 1029-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000025
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 7 Region: 186-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000893
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 8 Region: 1102-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family EGF-type module 0.025
Further Details:      
 
Domain Number 10 Region: 1064-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 1152-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000471
Family EGF-type module 0.027
Further Details:      
 
Domain Number 13 Region: 227-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000075
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 14 Region: 285-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016169
Domain Number - Region: 773-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 812-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0545
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0636
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016169   Gene: ENSMMUG00000012322   Transcript: ENSMMUT00000017265
Sequence length 1294
Comment pep:known_by_projection chromosome:MMUL_1:1:173053621:173260207:-1 gene:ENSMMUG00000012322 transcript:ENSMMUT00000017265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKGFSKDNDCSCSGTA
NNVDKDCDNVKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGTCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPLDYSGYTGAQCEIDINECNSNPCQSDG
ECVELSSEKQYGHITGLPSTFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTC
ENLPGNYTCHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGICIPHFQDGQHGFGCLCP
SGYTGSLCEIATTLSFEGDGFLWVKTGSATTKGSVCNIALRFQTVQPVALLLFRGNRDVF
VKLELLSGYIHLSIQVNSQPKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCI
SKAPSPLESDQSICAFQNSFLGGLPVGTTSDGVALLKFYNIPSTPSFVGCLQDIKIDWNH
ITLENISSVSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREFV
AGRFGQNDSTGYVVFTLDESYGDTVSLSMFVQTLQPSGLLLALENSTYQYIRVWLEHGRL
AMLTPNSPKLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIYI
GGLPDKQETELNGGFFKGCIQDVRLNNQNLEFFPNSTNNVSLKPVLVNVTQGCPGDNSCK
SNPCRNGGVCHSLWDDFSCSCPAHMSGKACEEVQWCGFSPCPHEAQCQPVLQGFECIANA
VFNEQSSQILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQL
QSGNSFYTLSLTSLQSVNDGMWHEVTLSMTDPMSQTSRWQMEVDNQTPFVTSTIATGSLN
FLKDNTDIYVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNKPQEEQFLKISTNS
VVTGCLQLSVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNTDECFSNPCIHGNCS
DRVAAYHCTCEPGYTGGNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQS
RLPSTVCGNEETNLTCYNGGNCTEFQAELKCMCRPGFTGERCEKDIDECASDPCVNGGLC
QDLLNKFQCLCDVAFAGERCEVDLADDLISDIFTAIGSVTLALLLILLLAIVASVVTSNK
RATQGTYSPSRQEKEGSRVEMWNLMPPPAMERLI
Download sequence
Identical sequences ENSMMUP00000016169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]