SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016239 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016239
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.47e-63
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016239   Gene: ENSMMUG00000015034   Transcript: ENSMMUT00000017339
Sequence length 214
Comment pep:known chromosome:MMUL_1:9:22764163:22805578:-1 gene:ENSMMUG00000015034 transcript:ENSMMUT00000017339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INELSHVQIPVMLMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGID
DQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVE
CHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKSP
TPAIVILPVPSAATSEKHFIDPMRVLLHFSSSNC
Download sequence
Identical sequences ENSMMUP00000016239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]