SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016244 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016244
Domain Number 1 Region: 27-260
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.54e-82
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000000000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016244   Gene: ENSMMUG00000012365   Transcript: ENSMMUT00000017344
Sequence length 272
Comment pep:known_by_projection chromosome:MMUL_1:16:48805381:48831679:-1 gene:ENSMMUG00000012365 transcript:ENSMMUT00000017344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPD
DFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINS
DSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRL
TVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQK
LHVGEESKKNFLEKLKRDVEEIFTLSPGWSEV
Download sequence
Identical sequences 9544.ENSMMUP00000016244 ENSMMUP00000016244 ENSMMUP00000016244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]