SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016279 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016279
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.54e-85
Family Proteasome subunits 0.000000000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016279   Gene: ENSMMUG00000012397   Transcript: ENSMMUT00000017383
Sequence length 246
Comment pep:novel chromosome:MMUL_1:7:157088755:157089495:1 gene:ENSMMUG00000012397 transcript:ENSMMUT00000017383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSSAGFDRHITIFSPEGRLYQIEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Download sequence
Identical sequences ENSMMUP00000016279 ENSMMUP00000016279 XP_014999894.1.72884 9544.ENSMMUP00000016279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]