SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016303 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016303
Domain Number 1 Region: 116-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000187
Family LIM domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016303
Domain Number - Region: 174-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000211
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016303   Gene: ENSMMUG00000012419   Transcript: ENSMMUT00000017409
Sequence length 314
Comment pep:known chromosome:MMUL_1:4:41619370:41621961:1 gene:ENSMMUG00000012419 transcript:ENSMMUT00000017409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPQGPSVLSLGSLCLDTNQAPKWTGLRTLLQQLPPQDIDEHYCLALGEEERAELRLFCS
RRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQTCFACQACG
QALINLIYFYHDGQLYCGRHHAELLRPRCPACDQLIFSQRCTEAEGQHWHENHFCCQDCA
GPLGGGRYALPGGSPCCPSCFENRYSDAGSSWAGALEGQTFLGAPPPHPPDPSLGARSSH
RASLAGAFRGPPEPTPRRGRGCGAGLPPRRGTRPPSGGGGGPWRGLAAAAVAAARTAQGL
GGARGWASPPLAAV
Download sequence
Identical sequences ENSMMUP00000016303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]