SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016307 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016307
Domain Number 1 Region: 935-1228
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-77
Family Protein kinases, catalytic subunit 0.0000000014
Further Details:      
 
Domain Number 2 Region: 306-468
Classification Level Classification E-value
Superfamily L domain-like 3.97e-44
Family L domain 0.00000244
Further Details:      
 
Domain Number 3 Region: 29-188
Classification Level Classification E-value
Superfamily L domain-like 1.11e-36
Family L domain 0.00000357
Further Details:      
 
Domain Number 4 Region: 466-586
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-23
Family Fibronectin type III 0.0000326
Further Details:      
 
Domain Number 5 Region: 745-894
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-23
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 6 Region: 588-656,757-779
Classification Level Classification E-value
Superfamily Fibronectin type III 8.3e-18
Family Fibronectin type III 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016307   Gene: ENSMMUG00000012422   Transcript: ENSMMUT00000017413
Sequence length 1285
Comment pep:known_by_projection chromosome:MMUL_1:1:135450752:135468543:-1 gene:ENSMMUG00000012422 transcript:ENSMMUT00000017413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRRLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVGLPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGESCAKTTFSGHTDYRCWTSSHCQRETAGSHGAGWSQDGMAQYFQCHCFLIRT
HPMRQVRKQREKLNNQCGIRQLRAAGECREGGGHPGSSEGLRRPKLVQGSGYLLAPASIF
CHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLVE
TITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQNLQQLGSWVAAGLTIP
VGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAACQTRTLRFVSNVTEA
DRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQ
EPGVTLASLKPWTQYAVFVRAITLTTDEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSN
SSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRGLRLPTSNNDPRFDRED
GDPEAEMESGCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPKSPWKVTSINKS
PQRDSGRHRRATGPLRLGDNSSDFEIQEDKVPRERAVLSGLRHFTEYRIDIHACNHAAHT
VGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPDPNGLILKYEIKYRRL
GEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGSWTDSVAFYILGPEEED
AGGLHVLLTATPVGLMLLIVLAALGFFYGKKRNRTLYASVNPEYFSASDMYIPDEWEVPR
EQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASPRERIEFLKEASVMKA
FKCHHVVRLLGVVSQGQPTLVIMELMTHGDLKSHLRSLRPEAENNPGLPQPALGEMIQMA
GEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPV
RWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELEG
CPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFYYSSECQGARGSLPPTD
AEPDSSPTPRGASSDCSPQNGGPGH
Download sequence
Identical sequences 9544.ENSMMUP00000016307 ENSMMUP00000016307 ENSMMUP00000016307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]