SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016315 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016315
Domain Number 1 Region: 494-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-81
Family Protein kinases, catalytic subunit 0.000000157
Further Details:      
 
Domain Number 2 Region: 62-183
Classification Level Classification E-value
Superfamily L domain-like 6.38e-23
Family Ngr ectodomain-like 0.00000066
Further Details:      
 
Domain Number 3 Region: 289-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 194-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000235
Family I set domains 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016315   Gene: ENSMMUG00000012424   Transcript: ENSMMUT00000017421
Sequence length 796
Comment pep:known_by_projection chromosome:MMUL_1:1:135470840:135491996:1 gene:ENSMMUG00000012424 transcript:ENSMMUT00000017421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGGRRGQLGWHSWAAGPGSLLAWLMLASAGASPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPQLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVHEQKLQCHGQ
GPLAHMPNASCGVPMLKVQVPNASVDVGDDVLLWCQVEGRGLEQAGWILTELEQSATVMK
SGALPSLGLTLANVTSDLNRKNVTCWAENDVGRAELSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSMLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
Download sequence
Identical sequences F7DJ75
ENSMMUP00000016315 ENSMMUP00000016315 XP_001114243.3.72884 9544.ENSMMUP00000016315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]