SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016336 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016336
Domain Number 1 Region: 3089-3185
Classification Level Classification E-value
Superfamily EF-hand 5.67e-40
Family EF-hand modules in multidomain proteins 0.00000406
Further Details:      
 
Domain Number 2 Region: 2964-3087
Classification Level Classification E-value
Superfamily EF-hand 1.27e-39
Family EF-hand modules in multidomain proteins 0.00000209
Further Details:      
 
Domain Number 3 Region: 9-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-32
Family Calponin-homology domain, CH-domain 0.000000689
Further Details:      
 
Domain Number 4 Region: 1930-2087
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-23
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 873-1029
Classification Level Classification E-value
Superfamily Spectrin repeat 2.32e-22
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 2038-2195
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-22
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 3165-3253
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2404-2565
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 213-323
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1090-1244
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 2631-2757
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 12 Region: 2780-2918
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-17
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 13 Region: 399-537
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 14 Region: 1507-1651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000432
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 15 Region: 1398-1519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000695
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1702-1846
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000212
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 17 Region: 332-433
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 2926-2963
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 19 Region: 653-776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000494
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 20 Region: 2163-2300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000013
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 21 Region: 2350-2418
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000223
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 22 Region: 1308-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000815
Family Spectrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016336
Domain Number - Region: 793-888
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000576
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016336   Gene: ENSMMUG00000019345   Transcript: ENSMMUT00000017443
Sequence length 3564
Comment pep:known chromosome:MMUL_1:X:29002035:30722960:-1 gene:ENSMMUG00000019345 transcript:ENSMMUT00000017443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDW
NSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQV
SIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQ
AAYVTTSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQ
AQGEISNDVEVVKEQFHTHEGYMMDLTAHQGRVGNILQLGSQLIGTGKLSEDEETEVQEQ
MNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEKEPLGPDL
EDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANI
CRWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDVVNRIHTTGFKDQNEMLSSLQKL
AVLKADLEKKKQSMDKLYSLKQDLLSTLKNKSVTQKMEAWLENFARCWDNLVQKLEKSTA
QISQAVTTTQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKR
LDVDITELHSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRS
AQVLVEQMVNEGVNADSIRQASEQLNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLE
QMTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSALQPQIERLKIQSITLKEKGQG
PMFLDADFVAFTNHFSQVFSDMQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLS
IPQLSVTDYEIMEQRLGELQVLQSSLQEQQSGLNYLSTTVKEMSKKAPSEISRKYQLEFE
EIETRWKKLSSQLAEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEI
LKKQLKQCRLLVNDIQTIQPSLNSVNEGGQKIKNEAEPEFALRLEIELKELNTQWDHMCQ
QVYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRA
KEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEE
VWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLHSLENLMQHSEDNPNQI
RILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQ
ESLTFIDKQLTAYIADKVDAAQMPQEAQASKIQSDLTSHEISLEEMKKHNQGKEAAQRVL
SQIDVAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQ
LNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTE
RKQQLEKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEI
EKQKVHLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHM
ETFDQNVDHITKWIIQADTLLDESEKKKSQQKEDVLKRLKAELNDIRPKVDSTRDQAANL
MANRGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEI
QQGVNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNAL
KDLRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQK
KKEELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREET
MMVMTEDMPLEISYVPSTYLTEITHVSQALSEVEQLLNAPDLCAKDFEDLFKQEESLKNI
KDILQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQIDFQWEKVNKMYKDRQGRFDR
SVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRT
LNATGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSERKKRLEEQKNILSEFQRDLN
EFVLWLEEADNIASIPLEPGNEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSA
PISPEEQDKLENKLKRTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLL
LWLSPIRNQLEIYNQPNQEGPFDIKETEIAVQAKQPDVEGILSKGQHFYKEKPATQPVKR
KLEDLSSEWKTVNHLLQELRAKQPDLAPGLTTVGASPSQTVTLVTQPVVTKETAISKLEM
PSSLMLEVPALADFNRAWTELTEWLSLLGRVIKSQRVMVGDLEDINEMIIKQKATVQDLE
QRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKD
STQWLEAKEEAEQVLGQARAKLESWKEGPYTIDAIQKKITETKQLAKDLRQWQINVDVAN
DLALKLLRDYSADDTRKVHMITENINASWGSIHKREREREREVEELQNALSEFFLSFSSY
LLKFTKVEMKEKILRAAREKGRSLENSKNWKELRHEWQDLQGEIEAHTDVYHNLDENSQK
VLRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWL
QLKDDELSRQTPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGL
EKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSTDWQRKIDETLERLQELQE
ATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQ
LTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPW
ERAISPNKVPYYINHETQTTCWDHPKMTELYQSLGKLLKVKFTLSQTKKKKRKKEKSIFV
DLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNW
LLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVSSSTGFCDQRRLGLLLHDS
IQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRV
AAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCT
PTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSA
PASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQ
DSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPS
PPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQ
AEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDVLSPPQDTSTGLEEVME
QLNNSFPSSRGRNTPGKPMREVSE
Download sequence
Identical sequences ENSMMUP00000016336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]