SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016362 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016362
Domain Number 1 Region: 23-162
Classification Level Classification E-value
Superfamily L domain-like 3.74e-23
Family Internalin LRR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016362   Gene: ENSMMUG00000012465   Transcript: ENSMMUT00000017472
Sequence length 199
Comment pep:known chromosome:MMUL_1:1:76990229:76999661:-1 gene:ENSMMUG00000012465 transcript:ENSMMUT00000017472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGTITEELTSHEEWSHYNENIREDQKDFVFVKFNGLHLKSMENLQSCISLRVCVVSNN
FITDIHPLQSCIKLIKLDLHGNQIKSLPDNKFWSGLKNLKLLYLHDNGFAKLKNICVLSA
CPNLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHR
LFFNFCPTLRKEKMKHSEV
Download sequence
Identical sequences F7FFR2
ENSMMUP00000016362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]