SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016379 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016379
Domain Number 1 Region: 781-850
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000109
Family IBR domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000549
Family PUG domain 0.0044
Further Details:      
 
Domain Number 3 Region: 698-763
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000565
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 861-933
Classification Level Classification E-value
Superfamily RING/U-box 0.0000102
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 5 Region: 352-377
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000589
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016379
Domain Number - Region: 574-613
Classification Level Classification E-value
Superfamily UBA-like 0.000199
Family UBA domain 0.013
Further Details:      
 
Domain Number - Region: 302-327
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00157
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 409-434
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00392
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Domain Number - Region: 215-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00858
Family TFIIH p44 subunit cysteine-rich domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016379   Gene: ENSMMUG00000012474   Transcript: ENSMMUT00000017489
Sequence length 1072
Comment pep:known chromosome:MMUL_1:7:87041167:87054383:1 gene:ENSMMUG00000012474 transcript:ENSMMUT00000017489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPPTARYLQLDAARLVRCN
AHGEPRNYLSTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPNEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSAPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
RLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGAQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDTLLASAQSHVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPVQRAPRPYASSLEKGPPKLGPPQRLSASLPSSCGDPGKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARKAWLDRHGNLDEAVEECVRTRRRKVRELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFHQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVMEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK
Download sequence
Identical sequences F7FF32
XP_001112195.1.72884 ENSMMUP00000016379 ENSMMUP00000016386 9544.ENSMMUP00000016379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]