SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016394 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016394
Domain Number 1 Region: 67-345
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 14-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-33
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016394   Gene: ENSMMUG00000022017   Transcript: ENSMMUT00000017506
Sequence length 382
Comment pep:known chromosome:MMUL_1:11:50273765:50294341:-1 gene:ENSMMUG00000022017 transcript:ENSMMUT00000017506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNC
IINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK
VSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFT
GLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVF
AFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQ
PYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPH
PNASSEDEVPGGQGKGGLKSPA
Download sequence
Identical sequences A0A1D5QUK5 A0A2J8KDA2 A0A2J8SX99 A0A2K5N2L8
ENSP00000332695 NP_001230659.1.87134 NP_001230659.1.92137 XP_003831074.1.60992 XP_008954671.1.60992 XP_008954672.1.60992 XP_011785925.1.43180 XP_011903503.1.92194 XP_011903504.1.92194 ENSMMUP00000016394 ENSP00000377947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]