SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016398 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016398
Domain Number 1 Region: 181-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000213
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 214-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000404
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016398   Gene: ENSMMUG00000012491   Transcript: ENSMMUT00000017511
Sequence length 295
Comment pep:known_by_projection chromosome:MMUL_1:3:168098159:168099274:-1 gene:ENSMMUG00000012491 transcript:ENSMMUT00000017511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAVACLDYFAAECLVSMSAGAVVHHRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
ASVPPLPSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCAPESSSGAP
AVPSAPAAPGAPAASGGVSGGALGAGPAPVADQVPRRRPVTPAAKRHQCPFPGCNKAYYK
SSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSD
HLTKHARRHPTYHPDMIEYRGRRRTPRVDPPLASEVESSASGSGPGPAPSFTTCL
Download sequence
Identical sequences ENSMMUP00000016398 9544.ENSMMUP00000016398 ENSMMUP00000016398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]