SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016449 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016449
Domain Number 1 Region: 14-80
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000852
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016449   Gene: ENSMMUG00000012530   Transcript: ENSMMUT00000017566
Sequence length 123
Comment pep:known chromosome:MMUL_1:15:97868272:97870976:-1 gene:ENSMMUG00000012530 transcript:ENSMMUT00000017566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSQDMKQSVPPGPADIRIVWEKNGRALETCVPVQTHALPDGSAHALSWLQDAIRESTEY
RCSVISSAGNKTSKVQVAVMRPEVAHQEKWSRELSAWRAVAGEHDRMMQSWRKAWESCSK
DTL
Download sequence
Identical sequences ENSMMUP00000016449 ENSMMUP00000016449 9544.ENSMMUP00000016449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]