SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016502 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016502
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 8.93e-43
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 284-376
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 419-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000104
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016502   Gene: ENSMMUG00000012572   Transcript: ENSMMUT00000017622
Sequence length 728
Comment pep:known chromosome:MMUL_1:4:40217364:40258141:-1 gene:ENSMMUG00000012572 transcript:ENSMMUT00000017622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATATVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGAQPPPPSSTPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRLPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGD
Download sequence
Identical sequences 9544.ENSMMUP00000016502 ENSMMUP00000016502 ENSMMUP00000016502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]