SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016576 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016576
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000344
Family LIM domain 0.0099
Further Details:      
 
Domain Number 2 Region: 189-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000542
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 68-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000105
Family LIM domain 0.0071
Further Details:      
 
Domain Number 4 Region: 130-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000698
Family LIM domain 0.0078
Further Details:      
 
Domain Number 5 Region: 251-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000106
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016576   Gene: ENSMMUG00000012621   Transcript: ENSMMUT00000017700
Sequence length 284
Comment pep:known chromosome:MMUL_1:4:92496030:92547612:1 gene:ENSMMUG00000012621 transcript:ENSMMUT00000017700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAQFYCQYCTASLLGKKYVLKDDSLFCVTCYDRVFSNYCEECKKPIESDSKDLCYKDR
HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCENCRQPIGTKPLISKESGNFCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICF
QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDSDI
Download sequence
Identical sequences F7F0V6 G7P427
ENSMMUP00000016576 ENSMMUP00000033333 ENSMMUP00000016576 NP_001270282.1.63531 XP_001100497.1.72884 XP_001100593.1.72884 XP_005552380.1.63531 XP_014992449.1.72884 XP_014992450.1.72884 9544.ENSMMUP00000016576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]