SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016605 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016605
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily RING/U-box 1.9e-36
Family RING finger domain, C3HC4 0.00000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016605   Gene: ENSMMUG00000012642   Transcript: ENSMMUT00000017731
Sequence length 105
Comment pep:known_by_projection chromosome:MMUL_1:10:84860870:84879026:1 gene:ENSMMUG00000012642 transcript:ENSMMUT00000017731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCGGCRNHQKAYCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
Download sequence
Identical sequences 9544.ENSMMUP00000016605 ENSMMUP00000016605 ENSMMUP00000016605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]