SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016610 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016610
Domain Number 1 Region: 739-833
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.04e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 605-693
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016610
Domain Number - Region: 795-905
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0115
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016610   Gene: ENSMMUG00000012644   Transcript: ENSMMUT00000017736
Sequence length 908
Comment pep:known chromosome:MMUL_1:16:41308972:41344817:1 gene:ENSMMUG00000012644 transcript:ENSMMUT00000017736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQVEAGAVQLRADSAIKEPLPME
DVCPEVVSMPPSVTEPPEKELSTMSKLPAEPPALLRAHPPRRRSESSGSLPNTIDMRLRP
ETRRDNSAKLELALTGGETKLIPLECPLSSPKGVLFPHKSAEVCKQESPFSRVPGRGQPG
YPAAPPEKHGSGERARETGGAEGTGDAVLGEKVLEEDLLSQEHVLELENSKAPNLASLEG
EEEKGKSSSSQVGPVQEEEYVAEKLPSRFIKSAHTELPKDDAAPAPPITDAKAQDRDVEG
ELGNEESLDRNEENLDRNEESLDRNEEGLDRNEEGLDRNGEGLDRNEEIEQAAFQIISQV
ISEATEQVLATAVGKVTGCVYQASQLQGQEEESCVPVHQQTVLGSDTGEPATAEAAAAPS
DAALPSPGLPAEGSAPPKTYVSCLNSPLSSPIKDSKPKISAHHISLTPCLPPTTPGEESP
DRAGILVEDATCVTCMSDSSQSVPLVASPGHCSDSLSTSGLEDSCTETSSSPRDKAITPP
LPESTVPFSNGVLKGELSDLGAEDGWTMDVEADHSGGSDRNSMDSVDSCCSLKKTESFQN
TQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQIC
HIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVV
NQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWW
RAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDD
DQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQW
VDSYYASL
Download sequence
Identical sequences G7NHQ6
9544.ENSMMUP00000016610 ENSMMUP00000016610 ENSMMUP00000016610 NP_001248570.1.72884 XP_014974584.1.72884 XP_014974585.1.72884 XP_014974586.1.72884 XP_014974588.1.72884 XP_014974589.1.72884 XP_014974590.1.72884 XP_014974591.1.72884 XP_014974592.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]