SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016684 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016684
Domain Number 1 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 181-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000006
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 3 Region: 66-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000188
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 5 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 224-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000583
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016684   Gene: ENSMMUG00000018375   Transcript: ENSMMUT00000017816
Sequence length 269
Comment pep:known chromosome:MMUL_1:1:122917846:122991703:-1 gene:ENSMMUG00000018375 transcript:ENSMMUT00000017816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPALLWALLALWLCRAAPARALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQHCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPETVRNKRNRALGKRQASLE
Download sequence
Identical sequences ENSMMUP00000016684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]