SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016690 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016690
Domain Number 1 Region: 79-158
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.41e-34
Family Fibrinogen C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016690   Gene: ENSMMUG00000012713   Transcript: ENSMMUT00000017823
Sequence length 198
Comment pep:known_by_projection chromosome:MMUL_1:15:7873139:7899789:1 gene:ENSMMUG00000012713 transcript:ENSMMUT00000017823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRKGHGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVGDVLDALQRDRGLGRPRA
KADLQRAPARGARPRGCATGSRPRDCLDVLLSGQQDDGIYSVFPTHYPAGFQVYCDMRTD
GGGWTVFQRREDGSVNFFRGWDAYRDGFGRLTGEHWLGPLDRCTLSLALLVPIAPSLTPP
HSFVNVLHPPVPGRPTPA
Download sequence
Identical sequences ENSMMUP00000016690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]