SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016785 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016785
Domain Number 1 Region: 591-711
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 487-595
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 270-393
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 4 Region: 166-274
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 699-805
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 381-491
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000128
Family Cadherin 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016785
Domain Number - Region: 60-131
Classification Level Classification E-value
Superfamily Cadherin-like 0.0895
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016785   Gene: ENSMMUG00000012777   Transcript: ENSMMUT00000017924
Sequence length 1341
Comment pep:novel chromosome:MMUL_1:X:90584356:91320549:1 gene:ENSMMUG00000012777 transcript:ENSMMUT00000017924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRVDFLIIYSPSSLSPLVSAVRANTTNCKKPVMDLLSGTYIFAVLLACVVFHSGAQEKN
YTIREEMPENVLIGDLLKDLNLSLVSNKSLSSAMQFKLVYKTGDVPLIRIEEGTGEIFTT
GARIDREKLCVGIPTDEQCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPTTVINIS
IPENSAINSKYTLPAAIDPDVGINGVQNYELIKGQNIFGLDVIETPEGEKMPQLIVQKEL
DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTS
VTQLHATDADIGENARIHFSFSNLVSNIAKRLFHLNSTTGLITIKEPLDREETPNHKLLV
LASDGGLVPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENVPLNTKIALITVTD
KDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLN
QSAMLFIKVKDENDNAPVFTQSLVTVSIPENNSPGIQLTKVSATDADTGPNAEINFLLGP
DAPPEFSLDRRTGMLTVLKKLDREKEEKYFFTVLAKDNGVPPLTSNVTVFVSVIDQNDNS
PAFTHNEYNFYVPENLPKHGTVGLITVTDPDYGENSAVTLSILDENDGFTIDSKTGVIRP
NISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLP
STDPGTVVFQVIAVDNDTGMNAEVRYSIVGENTRDLFEINETTGNIIMKEKCDVTDLGLH
RVLVKANDLGQPDSLFSVVTVNLFVNESVTNATLINELLHKSTEAPVTPNTEIADASSPT
IDYVKILVAVVAGTITVVVVISITAVVRCRQAPHLKAAQKNKQNSEWATPNPENRQMIMM
KKKKKKKKHPPKNLLLNFVTIEETKADDVDDDGNSITLELPIDLEEQTMGKYNWVTTPTT
FKPDSPDLARHYKSASPQPAFQIQPETPLNSKHHIIQELPLDNTFVACDSISKCSSSSSD
PYSVSDSGYPVTTFEAPVSVHARPSQRRVTFHLPEGSQESGSDGGVGDQDAGSLTSASHG
LPLGYPQEEYFDHVTPNNRTEGDGNSDPECSNFPGLTAEITVQPTVEEASDNCTQECLIY
GHSDACWMPASLNDSSSSQAQASALCHSPPLSQASTHHHSPPVTQTIALCHSPPVTQTIA
LCHSPPPIQISALHHSPPLAQATALRHSPPSAQASALCYSPPLAQAAAICHGSPLPQVTA
LHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTF
TPRQKARPSKGDSPIMEEHPL
Download sequence
Identical sequences ENSMMUP00000016785 ENSMMUP00000016785 9544.ENSMMUP00000016785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]