SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016796 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016796
Domain Number 1 Region: 119-325
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.02e-37
Family Papain-like 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016796
Domain Number - Region: 73-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000654
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016796   Gene: ENSMMUG00000012784   Transcript: ENSMMUT00000017935
Sequence length 335
Comment pep:known_by_projection chromosome:MMUL_1:4:53993531:54076875:1 gene:ENSMMUG00000012784 transcript:ENSMMUT00000017935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGYKILIFSYLTAEIWMEKQYLPQREVDLEAYFTTNHTVLQGTRFKRAIFQGQYCRNF
GCCEDRDDGCVTEFYEANALCYCDKFCDRENSDCCPDYKSFCHEEKEWPPHTQPWYPEGR
WTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTLLLVSHACYPLFKDQNANNGCA
MASRSDGRGKRHATKPCPNNIEKSNRIYQCSPPYRVSSSETEIMKEIMQNGPVQAIMQVR
EDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGRKEKFWIAANSWGKS
WGENGYFRILRGVNESDIEKLIIAAWGQMTSSDEP
Download sequence
Identical sequences ENSMMUP00000016796 9544.ENSMMUP00000016796 ENSMMUP00000016796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]