SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016797 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016797
Domain Number 1 Region: 425-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-73
Family Eukaryotic proteases 0.00000000181
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.000000448
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.0000629
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000695
Family Complement control module/SCR domain 0.0000164
Further Details:      
 
Domain Number 5 Region: 305-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000571
Family EGF-type module 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016797   Gene: ENSMMUG00000012786   Transcript: ENSMMUT00000017937
Sequence length 688
Comment pep:novel chromosome:MMUL_1:11:7259335:7276492:1 gene:ENSMMUG00000012786 transcript:ENSMMUT00000017937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVLFCLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIMSGDIEEGRLCGQRTSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTVRREDFDVEPADSEGNCLDSLVF
VAGDQQFGPYCGRGFPGPLNIETKSNVLDIIFQTDLTGQNKGWKLRYHGDPMPCPKEETP
TSVWEPAKAKYVFRDVVRITCLDGFEVVEGRVGATSFHSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVTRYTCEEPYYYMENGGNGQYHCASNGSWVNEALSPELPK
CVPVCGVPREPFEGKQRIIGGSDADIKNFPWQVFFDNPWAGGALIDEYWVLTAAHVVEGN
QEPTMYVGSTSVQTSRLAKSKMLTSERVFIHPGWKLLEVPEARTNFDNDIALVQLKDPVK
MGPTVAPICLPGTSSDYNLMDGDLGLIAGWGRTEKRDRALRLKAARLPVAPLRKCREVKV
ENPKADAGAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKAKFYVAGLVSWGPQCG
TYGLYTRVQNYVDWIKKTMQENSTPSKD
Download sequence
Identical sequences ENSMMUP00000016797 9544.ENSMMUP00000016797 ENSMMUP00000016797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]