SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016893 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016893
Domain Number 1 Region: 116-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000174
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 40-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000393
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000183
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 152-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000227
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016893   Gene: ENSMMUG00000012860   Transcript: ENSMMUT00000018043
Sequence length 195
Comment pep:known chromosome:MMUL_1:20:29168375:29171635:1 gene:ENSMMUG00000012860 transcript:ENSMMUT00000018043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERRYKCSQCGKTYKHAGSLTNHRQSHTLGIYPCAICFKEFSNLMALKNHSRLHAQYRPYH
CPHCPRAFRLPRELLEHQQSHEASSERPFSCEVCGRSYKHAGSLINHRQSHQTGHFGCQA
CSKGFSNLMSLKNHRRIHADPRRFRCSECGKAFRLRKQLASHQRVHMERHRPFRCGQCGR
TYRHAGSLLNHRRSH
Download sequence
Identical sequences ENSMMUP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]