SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017018 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017018
Domain Number 1 Region: 225-348
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 16-140
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 339-434
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 121-241
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-19
Family Cadherin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017018   Gene: ENSMMUG00000014733   Transcript: ENSMMUT00000018179
Sequence length 454
Comment pep:known chromosome:MMUL_1:9:65255695:65285650:-1 gene:ENSMMUG00000014733 transcript:ENSMMUT00000018179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASLGVCGTASSMVIVYVEDVNDEAPVFTQQQYSRLGLRETAGIGTSVIVVRATDRDSGD
GGLVNYRILSGAEGKFEIDESTGLIITVDYLDYETKTSYMMNVSATDQAPPFNQGFCSVY
ITLLNELDEAVQFSNASYEVAILENLALGTEIVRVQAYSIDNLNQIMYRFDAYTSTQAKA
LFKIDAITGVITVQGLVDREKGDFYTLTVVADDGGPKVDSTVVYITVLDENDNRPRFDFI
SDSSIIIPEDCPVGQRVATVKARDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFV
ARPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENV
GGGTAVVQVRATDRDIGINSVLSYYITEGNKDMTFRMDRVSGEIATRPAPPDRERQSFYH
LVVTVEDEGTPTLSVSEGGGHREEHLGQSGSASE
Download sequence
Identical sequences ENSMMUP00000017018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]