SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017023 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017023
Domain Number 1 Region: 2501-2628
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-31
Family Cadherin 0.00083
Further Details:      
 
Domain Number 2 Region: 2067-2170
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-28
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 1410-1534
Classification Level Classification E-value
Superfamily Cadherin-like 6e-27
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 884-993
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00075
Further Details:      
 
Domain Number 5 Region: 1524-1630
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 2400-2505
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.00072
Further Details:      
 
Domain Number 7 Region: 1096-1219
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 1632-1748
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-25
Family Cadherin 0.00084
Further Details:      
 
Domain Number 9 Region: 1741-1847
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 995-1108
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 671-776
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 1849-1963
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-23
Family Cadherin 0.00087
Further Details:      
 
Domain Number 13 Region: 2603-2728
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 1200-1324
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 120-204
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 777-884
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 17 Region: 2290-2398
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 1305-1425
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-18
Family Cadherin 0.0022
Further Details:      
 
Domain Number 19 Region: 1957-2073
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-17
Family Cadherin 0.001
Further Details:      
 
Domain Number 20 Region: 2171-2289
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-17
Family Cadherin 0.00095
Further Details:      
 
Domain Number 21 Region: 588-677
Classification Level Classification E-value
Superfamily Cadherin-like 2e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 22 Region: 2714-2813
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000628
Family Cadherin 0.0021
Further Details:      
 
Domain Number 23 Region: 347-457
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000214
Family Cadherin 0.0051
Further Details:      
 
Domain Number 24 Region: 2838-2956
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000385
Family Cadherin 0.0029
Further Details:      
 
Domain Number 25 Region: 256-354
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.005
Further Details:      
 
Domain Number 26 Region: 460-514
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000657
Family Cadherin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017023   Gene: ENSMMUG00000014733   Transcript: ENSMMUT00000018184
Sequence length 3323
Comment pep:known chromosome:MMUL_1:9:65183531:65561662:-1 gene:ENSMMUG00000014733 transcript:ENSMMUT00000018184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGDSERQMMAQTL
YMPMLVNGKAHVQASKQTCTALDTLCDIMRFPLEPETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIITVIRELDYETTQAYQLTSNGAFQWDTDPVAHTRGSVITIVVTVMIEMRLALLR
LHSSQGIQTQVPPLFCQGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGALT
LNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYS
VAITELAQVGFALPLFIQVVDKDEDWGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIR
VAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVT
VGTSVLTVLATDNDAGTFGEVNYFFSDDPDRALDWKLEPMGTVAGLTLIVAQPCTRGASR
VPGPGQDPGLDHPIKELSAGPAFPSLAAAHPLLVLSLLQAHGSCLPSSFQATDEDSPPNN
QITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAKDAGNPPLNST
VPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLE
GSAQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDN
HPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNGTTGKIR
TTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLRATSSATVFVNLLDLNDNDPTFQNLP
FVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELD
RERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDEMPTFFPAVYNVSVSEDVPREFRV
VWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVSLDRETTAAYMLILEAID
NGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILKATDADEGEFGR
VWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIV
YVEDVNDEAPVFTQQQYSRLGLRETAGIGTSVIVVRATDRDSGDGGLVNYRILSGAEGKF
EIDESTGLIITVDYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNA
SYEVAILENLALGTEIVRVQAYSIDNLNQIMYRFDAYTSTQAKALFKIDAITGVITVQGL
VDREKGDFYTLTVVADDGGPKVDSTVAVYITVLDENDNRPRFDFISDSSIIIPEDCPVGQ
RVATVKARDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILK
VVASDRGTPPRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRD
IGINSVLSYYITEGNKDMTFRMDRVSGEIATRPAPPDRERQSFYHLVVTVEDEGTPTLSA
TTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVIYAIVA
GNIINTFRIDRHMGVISTAKELDYEISHGRYTLIVTATDQCPILSRRLTSTTTVLVNVND
INDNMPTFPRHYEGPFEVTEGQPGPRVWTFLAHDRDSGPNGQVEYSIVDGDPLGEFVISP
VEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPM
NITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDR
ERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGT
PLTVLNGPILALDADEDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFLPPI
LELLLLAEDIGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDE
DSGLNGELVYRIEAGAQDRFFIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSG
TAIITILIEDINDSCPEFLNPIQTVSVLESAEPGTVIANVTAIDRDLNPKLEYHIVGIVA
KDDTDLLVPDQEDVFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPN
AKLTVNVLDVNDNTPQFKPFGITYYTERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLL
DLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDIN
DNNPIFDQPSYQEAVFEDVPVGTVILTVTATDADSGNFALIEYSLGDGEGKFAINPTTGD
IYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFST
SVYENEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYER
FNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFWLMPEPSSPHFPQEIPLSSNVYEVY
ATDKDEGLNGAVRYSFLKTAGNRDWEFFTIDPLSGLIQTAQRLDRETQAVYSLILVASDL
GQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDA
DEGLNAIVYYFIAVGNEEKNFHLQPDGRLLVLRDLDREREAIFSFIVKASSNRSWTPPRG
PSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIG
NNSLVFYSILAIHYFQALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARD
LAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRSFEEEFIHLLSNITGAIVNTDDVQFHV
DKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISV
RLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMD
MPNTNKYSFDGANPVWLDPFCRNLELATQAEHEDDLPENLSEIADLWNSPTRTHGTFGRE
PAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKLIQTELDEEPRDHSPGQGSLRFRHK
PPVELKGPDGIHVVHGSTGTLLATDLNSLPEDDQKGLGRSLETLTAAEATAFERNARTES
AKSTPLHKLRDVIMESPLEITEL
Download sequence
Identical sequences ENSMMUP00000017023 9544.ENSMMUP00000017023 ENSMMUP00000017022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]