SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017070 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017070
Domain Number 1 Region: 26-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-62
Family Proteasome subunits 0.00000000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017070   Gene: ENSMMUG00000012999   Transcript: ENSMMUT00000018233
Sequence length 239
Comment pep:known chromosome:MMUL_1:16:4586534:4588850:1 gene:ENSMMUG00000012999 transcript:ENSMMUT00000018233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLAARGTGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAIATLPPP
Download sequence
Identical sequences A0A2K5VQT6 G7NI33
NP_001182643.1.72884 XP_005582641.2.63531 XP_011723759.1.29376 ENSMMUP00000017070 9544.ENSMMUP00000017070 ENSMMUP00000017070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]