SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017075 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017075
Domain Number 1 Region: 403-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.02e-77
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-33
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017075   Gene: ENSMMUG00000013004   Transcript: ENSMMUT00000018240
Sequence length 728
Comment pep:known_by_projection chromosome:MMUL_1:2:179570157:179628099:-1 gene:ENSMMUG00000013004 transcript:ENSMMUT00000018240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYHALCFSLSKASAHTVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPINTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLVTFSTRNNLTTYKSEIRYSCQEPYYKMLNNITGIYTCSAQGVW
MNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVV
LHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPSPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVILDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQG
RAPGGTVS
Download sequence
Identical sequences F7HR39
ENSMMUP00000017075 9544.ENSMMUP00000017075 ENSMMUP00000017075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]