SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017076 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017076
Domain Number 1 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-34
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 3 Region: 300-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017076   Gene: ENSMMUG00000013004   Transcript: ENSMMUT00000018241
Sequence length 380
Comment pep:known_by_projection chromosome:MMUL_1:2:179582897:179628356:-1 gene:ENSMMUG00000013004 transcript:ENSMMUT00000018241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYHALCFSLSKASAHTVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPINTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKKNEIDLESELKSEQVTE
Download sequence
Identical sequences ENSMMUP00000017076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]