SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017112 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017112
Domain Number 1 Region: 125-319
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.6e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 442-544
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 326-435
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-36
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 4 Region: 546-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017112   Gene: ENSMMUG00000013031   Transcript: ENSMMUT00000018281
Sequence length 622
Comment pep:known chromosome:MMUL_1:8:22089046:22120359:1 gene:ENSMMUG00000013031 transcript:ENSMMUT00000018281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAADLRQHTTRKSSIKGAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEGCYDLQVGKPLL
WDRHCFRLSTHRPEMLGTALRG
Download sequence
Identical sequences ENSMMUP00000017112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]