SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017138 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017138
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.84e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 
Domain Number 2 Region: 85-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.44e-23
Family Skp1 dimerisation domain-like 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017138   Gene: ENSMMUG00000013046   Transcript: ENSMMUT00000018307
Sequence length 160
Comment pep:novel chromosome:MMUL_1:6:130565460:130579590:-1 gene:ENSMMUG00000013046 transcript:ENSMMUT00000018307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKYTLRKTTVSLQAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSKVLSL
Download sequence
Identical sequences 9544.ENSMMUP00000017138 ENSMMUP00000017138 ENSMMUP00000017138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]