SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017191 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017191
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.16e-58
Family Proteasome subunits 0.0000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017191   Gene: ENSMMUG00000013090   Transcript: ENSMMUT00000018360
Sequence length 201
Comment pep:known chromosome:MMUL_1:1:38420077:38459527:-1 gene:ENSMMUG00000013090 transcript:ENSMMUT00000018360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
Download sequence
Identical sequences A0A096MX69 A0A0D9S7T7 A0A140VJS6 A0A2I3HJF8 A0A2K5EM74 A0A2K5HUX5 A0A2K5N213 A0A2K5QIB6 A0A2K6A235 A0A2K6DU55 F6XJL9 G2HHM9 G3SJ48 G7NTH2 P49721 U3BW63
gi|4506195|ref|NP_002785.1| ENSPTRP00000000924 1iru_K 1iru_Y 5a0q_K 5a0q_Y 5gjq_d 5gjq_r 5gjr_d 5gjr_r 5l4g_2 5l4g_V 5le5_J 5le5_X 5lex_J 5lex_X 5ley_J 5ley_X 5lez_J 5lez_X 5lf0_J 5lf0_X 5lf1_J 5lf1_X 5lf3_J 5lf3_X 5lf4_J 5lf4_X 5lf6_J 5lf6_X 5lf7_J 5lf7_X 5ln3_4 5t0c_AQ 5t0c_BQ 5t0g_Q 5t0h_Q 5t0i_Q 5t0j_Q 6avo_T 6avo_V cath|current|1iruK00/1-199 cath|current|1iruY00/1-199 ENSMMUP00000017191 ENSP00000362334 ENSMMUP00000017191 ENSNLEP00000013474 Hs4506195___KOG0177 ENSP00000362334 9544.ENSMMUP00000017191 9606.ENSP00000362334 ENSP00000362334 1iruK NP_001233318.1.37143 NP_001244354.1.72884 NP_002785.1.87134 NP_002785.1.92137 XP_003273452.1.23891 XP_003812620.1.60992 XP_004025490.1.27298 XP_004472289.1.11602 XP_005544054.1.63531 XP_007977630.1.81039 XP_011761702.1.29376 XP_011810730.1.43180 XP_011851017.1.47321 XP_011934903.1.92194 XP_012295326.1.9421 XP_017830043.1.60252 ENSPTRP00000000924 ENSPANP00000004480 ENSNLEP00000013474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]