SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017243 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000017243
Domain Number - Region: 4-82
Classification Level Classification E-value
Superfamily RAP domain-like 0.0445
Family RAP domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017243   Gene: ENSMMUG00000013127   Transcript: ENSMMUT00000018415
Sequence length 129
Comment pep:novel chromosome:MMUL_1:1:45377256:45392552:1 gene:ENSMMUG00000013127 transcript:ENSMMUT00000018415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQVAKKLGVAHEEIQRLTDELQVKEKEQCKLDSALKKAQLEIDKLKENLVKQKENDAAD
LQKAKEHNQRLDEEILALRNRVRSLDSEKKVLGEMVERLKGEVCESQDNKQLEDHSPGKT
VGGEQREQV
Download sequence
Identical sequences F6ZGK9
9544.ENSMMUP00000017243 ENSMMUP00000017243 ENSMMUP00000017243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]