SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017282 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017282
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily DNA clamp 5.76e-17
Family DNA polymerase processivity factor 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017282
Domain Number - Region: 162-237
Classification Level Classification E-value
Superfamily DNA clamp 0.0848
Family DNA polymerase processivity factor 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017282   Gene: ENSMMUG00000013155   Transcript: ENSMMUT00000018456
Sequence length 409
Comment pep:known chromosome:MMUL_1:11:111434769:111471467:1 gene:ENSMMUG00000013155 transcript:ENSMMUT00000018456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCVMSGSQVKVFGKAVQALSRISDELWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQ
HYQWSALVKMSENELDTTLNLKCKLGMKSILPIFRCLNSLERNIEKCKIFTRSDKCKVVI
QFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAV
TPLNFCLKSSNEESMDLSNAVYSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFSEAT
HAPISIYFDFPGKPLALSIDDMLVEANFILATLADESSRASSPQSLCLSQKRKRSDLIKK
KAGKNITGQALECISRKAAPRRLYPKETLTNISALENCGSPAMKRANGDVSEVSENSVSN
TEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNV
Download sequence
Identical sequences ENSMMUP00000017282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]