SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017340 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017340
Domain Number 1 Region: 23-92
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000523
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 2 Region: 156-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017340   Gene: ENSMMUG00000013197   Transcript: ENSMMUT00000018516
Sequence length 308
Comment pep:known chromosome:MMUL_1:1:88364190:88365720:1 gene:ENSMMUG00000013197 transcript:ENSMMUT00000018516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAVGCI
PLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSVKDPMDDQDGLLGKELGFDASEVE
LTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLHGQKCIVQTTSWSQCSKTCGTGISTRV
TNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVRFTYAGCSSVKKYRP
KYCGSCVDGRCCTPQLTRCEDAVPLRRWGDIFQERHDDPVKCNYNCPHANEAAFPFYRLF
NDIHKFRD
Download sequence
Identical sequences ENSMMUP00000017340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]