SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017364 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017364
Domain Number 1 Region: 29-75
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000353
Family Elafin-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017364   Gene: ENSMMUG00000013217   Transcript: ENSMMUT00000018540
Sequence length 112
Comment pep:known chromosome:MMUL_1:10:19313709:19314311:1 gene:ENSMMUG00000013217 transcript:ENSMMUT00000018540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSSFLVLMVSLALVTLVAAEGVKGAGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGER
KCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK
Download sequence
Identical sequences ENSMMUP00000017364 9544.ENSMMUP00000017364 ENSMMUP00000017364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]