SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017371 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017371
Domain Number 1 Region: 3-297
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-75
Family Rhodopsin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017371   Gene: ENSMMUG00000013222   Transcript: ENSMMUT00000018547
Sequence length 297
Comment pep:novel chromosome:MMUL_1:11:52662615:52663505:1 gene:ENSMMUG00000013222 transcript:ENSMMUT00000018547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMANQTVVTEFFLQGLTDTKELQVAVFLLLLLAYLVTVSGNLTIISLTLLDTCLQTPMY
LFLRNLSCLEIWFQTVIVPKMLLNIATGTKTISFAGCITQDFFHIFLGATEFFLLTAMAY
DRYIAICKPLHYPVLISSRVCTELILTCWLLGFSFIIVPVILTSQLPFCDTHINHFFCDY
TSLMEVVCSGPKVLEMVDFTLALVALLGTLVLITLSYVQIVRTIVRIPSVQERRKAFSTC
SSHVIVVTMCYGSCFFMYVKPSPGKGVDVNKGVSLINTIIAPLLNPFIYTLRNQQVK
Download sequence
Identical sequences 9544.ENSMMUP00000017371 ENSMMUP00000017371 ENSMMUP00000017371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]