SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017467 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017467
Domain Number 1 Region: 476-587
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 229-361
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 581-689
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 112-211
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 690-803
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 23-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000785
Family Cadherin 0.0024
Further Details:      
 
Domain Number 7 Region: 923-1046
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000714
Family Cadherin 0.002
Further Details:      
 
Domain Number 8 Region: 798-905
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000128
Family Cadherin 0.0051
Further Details:      
 
Domain Number 9 Region: 365-482
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000371
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017467   Gene: ENSMMUG00000013283   Transcript: ENSMMUT00000018647
Sequence length 1307
Comment pep:known_by_projection chromosome:MMUL_1:6:173049292:173082200:1 gene:ENSMMUG00000013283 transcript:ENSMMUT00000018647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLWLSCFLLPALVVSVAANMAPKFLANMTSVILAEDLPVGAQVFWLVAEDPDNDPLTY
GMSGPNAYFFTVTPNTGEVKLASALDYETLYTFKVTISVSDPYTQVQKEMQVIVEDRNDN
APVFQNTAFSTSINETLPVGSVVFSVLAVDKDMGPAGMVVYSIEKVIPSTGDSEHLFRIL
ANGSIILSGSLSYNNKSAFYQLELKACDLGGMFNNSFTIQCSLPAFLSISVVDQPDLDPQ
FVREFYSASVAEDAAKGTSVLKVEAVDGDKGINDPVIYSISNSTWPGWFDIGADGVIRVN
GSLDREQLLEEDEEVQLQVTATETHLNIYGQEAKVSIWVTVRVLDVNDHKPEFYNCSLPA
CTFTPEEAQVNFTGYVDEHASPRIPIDDLTMVVYDPDKASGSNGTFLLSLGGPDAEAFSV
SPVRAAGSASVQVLVRVSALVDYERQTVMVVQVVATDSVSQNFSIAMVTIHLRDINDHRP
TFPQSLYILRVPEHSATGSVVTDSIHATDPDTGAWGQITYSLLPGNGVDLFQVDPVSGTV
TVRNGELLDREIQAVYYLTLQATDGGNLSSSTMLQIHLLDINDNAPVVSGSYNIFVQEEE
GNVSVTIQAHDNDEPGTNNSRLLFSLLPGPYNHNFSLDPDTGLLRNLGPLDREAIDPALG
GRIVLTVLVSDCGEPVLSTEVNVTITVEDINDNLPIFNQSSYNFTVKEEDPGVLVGVVKA
WDADQTEVNNRISFSLSGSGANYFMIRGLVLGAGWAEGYLRLPPDVSLDYETQPVFNLTV
SAENPDPQGSETIVDVHVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDT
SAQLEIQLVNILCTKAGVDVGSLCWGWFSVVANGSVYINQSEAIDYEACDLVTLVVRACD
LATDPGFQAYSNNGSLLITIEDINDNAPYFLPEDKTFVIIPELVLPNREVASVQARDDDS
GNNGLILFSILRVDFISKDGATIPFQGIFWISSSSEADVFTGSIQPVTSLDSTLQGTYQV
TVQARDTPSVGPSLEANTTLNLFTVDQSYRSRLQFSIPKAEVGANREAINEALTQATRTT
VYIVDIQDIDSAARARAHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLMQLLQLGLVVL
GSQESQESDLSNQLISVIIGLGVALLLVLVIMTTAFMCVRKRCDSHCLCKELGFRHRYTC
IHSPQGPPVGHSLDQRPQEGQGRTPAKEPLVLSLKPRHSPRAWGACPTLPCPSHLLSLSM
QEYRPPHTPPEPDPEPLSVVLSRQQAGASGQLEGPSYTNAGLDTTDL
Download sequence
Identical sequences ENSMMUP00000017467 9544.ENSMMUP00000017467 ENSMMUP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]