SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017488 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017488
Domain Number 1 Region: 100-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-54
Family RecA protein-like (ATPase-domain) 0.000000000836
Further Details:      
 
Domain Number 2 Region: 16-81
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000251
Family DNA repair protein Rad51, N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017488   Gene: ENSMMUG00000013298   Transcript: ENSMMUT00000018668
Sequence length 340
Comment pep:known_by_projection chromosome:MMUL_1:10:82423188:82474325:-1 gene:ENSMMUG00000013298 transcript:ENSMMUT00000018668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALC
NVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMA
ITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVD
HDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELA
ERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTR
ISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Download sequence
Identical sequences A0A096NK25 A0A0D9R2Q2 A0A1D5QFF0 A0A2K5VU11 G3R6H9 H2P4D8 H2QLN6 Q14565
W00520 9544.ENSMMUP00000017488 9600.ENSPPYP00000013188 9606.ENSP00000216024 NP_008999.2.87134 NP_008999.2.92137 XP_001094012.1.72884 XP_003821641.1.60992 XP_005567346.1.63531 XP_005567347.1.63531 XP_007973954.1.81039 XP_007973955.1.81039 XP_008973336.1.60992 XP_008973337.1.60992 XP_008973338.1.60992 XP_008973339.1.60992 XP_009436676.2.37143 XP_009436677.2.37143 XP_009436679.2.37143 XP_015005848.1.72884 XP_018873486.1.27298 ENSP00000216024 gi|23238219|ref|NP_008999.2| ENSMMUP00000017488 ENSP00000216024 ENSPPYP00000013188 ENSPPYP00000013188 ENSP00000216024 ENSPANP00000013329 ENSMMUP00000017488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]