SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017517 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017517
Domain Number 1 Region: 1237-1513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-56
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 242-505,538-609
Classification Level Classification E-value
Superfamily L domain-like 9.52e-45
Family Leucine rich effector protein YopM 0.039
Further Details:      
 
Domain Number 3 Region: 631-819
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000121
Family G proteins 0.0085
Further Details:      
 
Domain Number 4 Region: 32-117,153-215
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000912
Family Ankyrin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 1535-1781
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000201
Family WD40-repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017517   Gene: ENSMMUG00000013325   Transcript: ENSMMUT00000018702
Sequence length 2010
Comment pep:known chromosome:MMUL_1:7:81101253:81200098:1 gene:ENSMMUG00000013325 transcript:ENSMMUT00000018702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSHAGAGDMGSKPSTPGGDPTAQSPRTEGIRAAYRQGDRGGARDLLKEACDQCTSQLEKG
QLLSIPAAYGDLEMVRYLLSERLVELPTEPMDDNPAVVAAYFGHTAIVQELLEPLTPKQT
EWEQVAPFSGTFPLSCHLLPGPCSPQRLLNWMLALACQQGHLGVVKLLVLTHGADPESYA
VRKNEFPVIVRLPLYAAIKSGNEDVAIFLLRHGAYFCSYILLDSPDPSKHLLRKYFIEAS
ALPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWGLINL
RKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTASKNCL
EKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFPDPWA
CPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENSLKEVPLGLFQLDALTFLRLQGNQ
LAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAACVLEFPA
FLSESLEVLCLNDNHLDAVPPSVCLLKSLSELYLGNNPGLRELPPELGQLSNLWQLDTED
LTISNVPAEIRKEGPKAMLCYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQTGRAP
QVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVW
NLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRS
PSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAGRLIP
RSYLSLQEAVLAEQQRRSLDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFLIETG
TLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGFT
QQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPAANTIQRVFKMSFVP
VGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVAIYSFTGNQRNRCSTFRVKRNQTI
YWQEGLLVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITDHVNSLIDQW
FPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEGVQYFDMEDCVLTAIERDFIS
CPRHPDLPVPLQELVPELFMTDFPARYAPKAPPRTHEDEGSVLGQGGSGTVIYRARYQGQ
PVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVALIGI
SIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKKNIIFC
DLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKV
DMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFHRLQALMMECWDT
KPEKRPLALSVVSQMKDPTFAIFMYELHCGKQTAFFSSQGQEYTVVFWDGKEESRNYTVV
NTEKGLMEVQRMSCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQRALDTPA
VVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGAPKDSCSYLCSHTANRSKFSIADED
ARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYAAPSVVTSVVCSSEG
RGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGDPSPLRDMFPVRPLDMEPLAASHTANP
KVPEGDSIADVSIMYSEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLPSSPAS
SSSVPFSPDCEDSDRLHEPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRG
GDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCSFENENTEWCLAV
WRGWGAREFDIFYQSYEELGRLEACTRKRR
Download sequence
Identical sequences ENSMMUP00000017517 9544.ENSMMUP00000017517 ENSMMUP00000030841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]