SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017589 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017589
Domain Number 1 Region: 30-238
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.72e-41
Family Fibrinogen C-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017589   Gene: ENSMMUG00000013391   Transcript: ENSMMUT00000018784
Sequence length 313
Comment pep:novel chromosome:MMUL_1:1:139511579:139520781:-1 gene:ENSMMUG00000013391 transcript:ENSMMUT00000018784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLSFLLFLIAATRGWITDEANTYSKEWTCSSSSSLPRTCKEIKDKCPSACDGLYFLRT
ENGVVYQTFCDMTSGGGGWTLVASVHENNMHGKCTAGDHWSSQQGSKADYPEGDGNWANY
NTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYHTDTGFLQTLG
HNLFGLYQKFPVKYGVGQCITDNGPAIPVVYDFGDAQKTASYYSPYGQLEFTAGFVQFRV
FNNERAANALCAGMKVTGCNTEHHCIGGGGYFPESSPRQCGDFSSFDWSGYGTHVGYSSS
REITEAAVLLFYH
Download sequence
Identical sequences F7AB32
ENSMMUP00000017589 9544.ENSMMUP00000017589 XP_002801914.1.72884 XP_014969150.1.72884 ENSMMUP00000017589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]