SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017596 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017596
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.52e-28
Family Glutathione peroxidase-like 0.000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017596   Gene: ENSMMUG00000013397   Transcript: ENSMMUT00000018791
Sequence length 123
Comment pep:known scaffold:MMUL_1:1099214793814:196:1504:1 gene:ENSMMUG00000013397 transcript:ENSMMUT00000018791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKA
KGVQVLACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRR
LKR
Download sequence
Identical sequences 9544.ENSMMUP00000017596 ENSMMUP00000017596 ENSMMUP00000017596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]