SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017611 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017611
Domain Number 1 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 372-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-23
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 413-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 278-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017611   Gene: ENSMMUG00000013408   Transcript: ENSMMUT00000018806
Sequence length 487
Comment pep:known_by_projection chromosome:MMUL_1:8:147449882:147460540:1 gene:ENSMMUG00000013408 transcript:ENSMMUT00000018806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMALPMPGPQEAVVFEDVAVYFTRIEWSCLAPDQQALYRDVMLENYGNLASLGFLVAKP
ALISLLEQGEEPGALILQVAEQSVAKASLCTDSRMEAGIVESPLQRKLSRQAGLPGTVWG
RLPGGHPAPPHPRGSPEDGSDKLTRPRARERSASPRVLQEDPGRPVGSSAPRYRCVCGKA
FRYNSLLLRHQVIHTGAKPFQCTECGKAFKQSSILLRHQLIHTEEKPFQCGECGKAFRQS
TQLAAHHRVHTRERPYVCGECGKAFSRSSRLLQHQKFHTGEKPFACTECGKAFCRRFTLN
EHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAEEGPQDGGAGQGALLRAAQRPQVGD
PPHECPVCGRPFRHNSLLLLHLRLHTGEKPFECAECGKAFGRKSNLTLHQKIHTKEKPFA
CTECGKAFRRSYTLNEHYRLHSGERPYRCRACGRACSRLSTLIQHQKVHGRERQEDTEGR
RAPRWAS
Download sequence
Identical sequences 9544.ENSMMUP00000017611 ENSMMUP00000017611 ENSMMUP00000017611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]