SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017768 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017768
Domain Number 1 Region: 226-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000928
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000519
Further Details:      
 
Domain Number 2 Region: 296-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000182
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017768
Domain Number - Region: 67-180
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0193
Family MBT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017768   Gene: ENSMMUG00000013510   Transcript: ENSMMUT00000018971
Sequence length 673
Comment pep:known chromosome:MMUL_1:16:7318321:7343973:-1 gene:ENSMMUG00000013510 transcript:ENSMMUT00000018971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLP
PPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLE
RLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITNSELFI
LSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLM
GLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQAL
LEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLH
ATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEES
RRRPIGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPP
ASARRRRSRRRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDG
SISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLPKGPSENGELS
APLELGSMVNGVS
Download sequence
Identical sequences A0A096P2R4 A0A0D9RG49 A0A2K5N8V4 A0A2K5VES1 A0A2K6BRC3 F6ZDG6
ENSPANP00000019639 NP_001253605.1.72884 XP_005582826.1.63531 XP_008008356.1.81039 XP_011725787.1.29376 XP_011908135.1.92194 ENSMMUP00000017768 9544.ENSMMUP00000017768 ENSMMUP00000017768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]