SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017928 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017928
Domain Number 1 Region: 1667-1912
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 691-826
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 3 Region: 1002-1143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 323-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000132
Family EGF-type module 0.002
Further Details:      
 
Domain Number 5 Region: 362-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000152
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 6 Region: 160-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000225
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 403-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000001
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 51-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 9 Region: 973-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 129-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 817-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000077
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 856-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 13 Region: 510-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000154
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 14 Region: 91-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 15 Region: 1231-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000375
Family EGF-type module 0.016
Further Details:      
 
Domain Number 16 Region: 894-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000401
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1141-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 1360-1393
Classification Level Classification E-value
Superfamily Notch domain 0.0000000759
Family Notch domain 0.0035
Further Details:      
 
Domain Number 19 Region: 628-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 1279-1311
Classification Level Classification E-value
Superfamily Notch domain 0.000000955
Family Notch domain 0.0014
Further Details:      
 
Domain Number 21 Region: 550-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 22 Region: 1319-1351
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.0049
Further Details:      
 
Domain Number 23 Region: 941-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000393
Family EGF-type module 0.04
Further Details:      
 
Domain Number 24 Region: 585-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000778
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 25 Region: 666-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000959
Family EGF-type module 0.028
Further Details:      
 
Domain Number 26 Region: 14-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017928
Domain Number - Region: 1184-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0155
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017928   Gene: ENSMMUG00000013637   Transcript: ENSMMUT00000019144
Sequence length 2209
Comment pep:known chromosome:MMUL_1:19:14755293:14787505:-1 gene:ENSMMUG00000013637 transcript:ENSMMUT00000019144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPRGFRGPDCSLPDPCLSSPCAHSARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEP
CRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPG
FEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHN
GGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGL
LCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGR
CVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCE
VDIDECQSSPCVNGGICKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPD
GYECRCAEGFEGMLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECR
SQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCSFGVCRDGINRYDCVCQP
GFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHG
ICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGR
QCELLSPCTPNPCEHGGLCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICT
NLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARD
VDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFS
CLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCPQSFTGPQCQTLVDWCSRQ
PCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSS
HYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGENCEDDVDECA
SQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVG
GFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVL
SPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARACRELQCPVGVPCQQT
PRGPRCACPPGLSGPSCRSFSGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGW
TGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQ
CEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQG
CNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRL
DAHGQAMVFPYHRPSPGSEPRARRELAPEVIGGEMRLIQVLCMSGAPPPGCDEQKMPPDG
ASASGVELPSPAPCFLLLGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHS
TLWFPEGFSLHKDVAAGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRL
KVEELGMGAEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTP
LMLASFCGGALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARA
DAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALIL
AARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKE
ETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRS
PPGTHGLGPLLCPPGAFLPGLKATQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPL
ADSSVTLSPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQP
PGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYL
AVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPS
PATATGAMATATGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences ENSMMUP00000017928 9544.ENSMMUP00000017928 ENSMMUP00000017928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]