SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017934 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017934
Domain Number 1 Region: 22-48,97-159
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.24e-23
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 166-260
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-17
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017934   Gene: ENSMMUG00000013644   Transcript: ENSMMUT00000019150
Sequence length 342
Comment pep:known_by_projection chromosome:MMUL_1:4:39130083:39150014:-1 gene:ENSMMUG00000013644 transcript:ENSMMUT00000019150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPRTRAGPEDRGWGCAVPSTVLLLFAYLAYLALGTGVFWTLEGRAAQESSRSFQRDKW
ELLQNFTCLDRPALDSLIRDVIQAYKNGASLLSNTTGMGRWELLGSFFFSVSTITTIGYG
NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHCSSRLGGTWQDPGKARWLA
GSGALLSGLLLFLLLPPLLFSHMEGWSYMEGFYFAFITLSTVGFGDYVIGMNPSRRYPLW
YKNVVSLWILFGMAWLALINSSSPSWRLQEGYVPATTTAPRKTSSPKAGDWAPTGSQRPT
PHSKNAIQRDLWESYGIWNLLLRLQAVARTASYTPFFGRDPG
Download sequence
Identical sequences ENSMMUP00000017934 9544.ENSMMUP00000017934 ENSMMUP00000017934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]