SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017944 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017944
Domain Number 1 Region: 13-40,89-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-24
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.2e-18
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017944   Gene: ENSMMUG00000013648   Transcript: ENSMMUT00000019161
Sequence length 309
Comment pep:known_by_projection chromosome:MMUL_1:4:39150697:39158209:-1 gene:ENSMMUG00000013648 transcript:ENSMMUT00000019161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNAGLCSCWGGRVLPLLLVYVCYLLLGATIFQLLERQAEAQSRYHFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGMGLRAHLATIERWEDRPRRSKVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKEAPGRRPRGSSTAARGVQVTPQDF
PISKRGLGS
Download sequence
Identical sequences F7GIH1
XP_001117141.1.72884 ENSMMUP00000017944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]