SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018075 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018075
Domain Number 1 Region: 53-323
Classification Level Classification E-value
Superfamily L domain-like 2.38e-42
Family Ngr ectodomain-like 0.027
Further Details:      
 
Domain Number 2 Region: 576-662
Classification Level Classification E-value
Superfamily Fibronectin type III 4.66e-17
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018075   Gene: ENSMMUG00000013745   Transcript: ENSMMUT00000019302
Sequence length 737
Comment pep:known_by_projection chromosome:MMUL_1:10:39344816:39354693:-1 gene:ENSMMUG00000013745 transcript:ENSMMUT00000019302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQTLLLLLLTVLHPSWADLLQKVPLFRVTQQGPWGSSGSNATDSPCEGLPAAGATALTL
ANRNLERLPGCLPRTLRSLNASHNLLRALSASELGHLEQLRVLTLSHNRIAELRWGPGGP
AGLHTLDLNYNQLAALTPCAGPALSSLRVLALAGNPLQALQPRAFACFPALQLLNLSCTA
LGRGAQGGIAEAAFAGEDGAPLATLEVLDLSGTFLQRVESGWIRDLPKLTSLYLRKMPRL
TTLEGDIFKMTPNLQQLDCQDSPALASVATHIFQDTPHLQVLLFQNCNLSSFPPWTLDSS
QVLSINLFGNPLTCSCDLSWLLMDAKRTVLSRAADTVCTPAAGSSGPFSASLSLSQLPGV
CQSNQSTTLRPSHPPGFNHSTYAQGPTVAPSAAPATRPEGDQQSVSKAPNVGSRTRAAWP
HSDAQEGTASSTTNSVAGHSHSSVFPRAASATASQHRGEHAPGLVLEPSISAASTPLESK
LLEPFPTSWNRISSPQPGQRTHTTPQAPNPSPSEGGIPVLLLDDYSEEEEGRKEEVGMPH
QDVPCDYHPCKHLQTPCAELQRQSRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHWCA
PNSVVHGYQIRYSVEGWAGNQSVVGVIYATARQHPLYGLSPGTTYRVCVLAANRAGLSQP
RSSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTLVLSACLCRRRQTLRLQRCDTHLV
ACKNPAFDYPLELQTVS
Download sequence
Identical sequences ENSMMUP00000018075 9544.ENSMMUP00000018075 ENSMMUP00000018075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]