SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018124 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018124
Domain Number 1 Region: 1634-1820
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-35
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 2 Region: 1456-1632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-33
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1045-1227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.63e-22
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 1227-1402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-21
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 5 Region: 831-1028
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-18
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 6 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 7 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 8 Region: 82-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000711
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018124
Domain Number - Region: 712-798
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0301
Family Chemotaxis phosphatase CheZ 0.023
Further Details:      
 
Domain Number - Region: 473-686
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0942
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018124   Gene: ENSMMUG00000013782   Transcript: ENSMMUT00000019353
Sequence length 1821
Comment pep:known chromosome:MMUL_1:4:151687321:151834760:1 gene:ENSMMUG00000013782 transcript:ENSMMUT00000019353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVARQDPPETSEPRVALGRL
PPAAEKCNAGFFRTLSGECVPCDCNGNSNECLDGSGFCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPRFCQLCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGLEPPTGTDCSTISCDKCVWDLTDDLRLAALSIEEGKSGVXX
XXXXXXXXVHIDLFSKHIFLTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKENQ
ASRKGQLIQKESMDTIKHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKLVL
AQKMLEEIRRRQPFFTQRELVDEEADEAHELLSQAESWQRLHNETRTLFPVVLEQLDDYN
AKLSDLQEALNQALNHVRDAEDMNRATAARQRDHEKQQERVREQMEAVNTSLNTSADSLT
TPRLTLSELDDIIKNASGIYAEIDGAKNELQVKLSNLSNLSHDLVQEAIDHAQELQQEAN
ELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDTQI
IYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQAA
ERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVDSAR
DAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDGQS
AVEVHSRTSMDDLKAFTSLSLYMKPPVRQPELTETADQFILYLGSKNAKKEYMGLAIKND
NLVYIYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIK
KGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPNSLNLPGFVGCLELATLNNDVISLYNFK
HIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAAVRDITKRGKFGQVTRFDIEVRTP
ADNSLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDTLKKAQINDAKYHEISII
YHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRTLRAHLPLDINFRGCM
KGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFN
FRTLQPNGLLFYYASGSDVFSISLDNGTVVMDVKGIKVQSVDKQYNDGLSHFVITSVSPT
RYELIVDKSRVGSKNPTKGKIEQTQAGEKKFYFGGSPISAQYANFTGCISNAYFTRVDRD
VEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWDPV
ALKFPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLRTR
SSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVVFIRER
SSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSNLQ
LNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSS
GTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNV
VQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGHP
VSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences 9544.ENSMMUP00000018124 ENSMMUP00000018124 ENSMMUP00000018125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]