SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018289 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018289
Domain Number 1 Region: 155-261
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.7e-29
Family ERP29 C domain-like 0.00000353
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.85e-24
Family ERP29 N domain-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018289   Gene: ENSMMUG00000013916   Transcript: ENSMMUT00000019531
Sequence length 261
Comment pep:known_by_projection chromosome:MMUL_1:11:112921504:112931855:1 gene:ENSMMUG00000013916 transcript:ENSMMUT00000019531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVSRAASLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVITKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEGRQAL
LKRGQDNLSSVKETEKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
Download sequence
Identical sequences A0A2K5UDP3 A0A2K6AX71 F6QVU7
ENSMMUP00000018289 ENSMMUP00000018289 9544.ENSMMUP00000018289 NP_001182664.1.72884 XP_005572342.1.63531 XP_011759288.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]