SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018350 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018350
Domain Number 1 Region: 604-755
Classification Level Classification E-value
Superfamily VPS9 domain 0.00000000000000183
Family VPS9 domain 0.021
Further Details:      
 
Domain Number 2 Region: 47-169
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000249
Family SH2 domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018350   Gene: ENSMMUG00000029233   Transcript: ENSMMUT00000019597
Sequence length 778
Comment pep:novel chromosome:MMUL_1:7:155763517:155876002:1 gene:ENSMMUG00000029233 transcript:ENSMMUT00000019597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVPAVGKGEEEEEEDGMGLCLPATPKNCLPRRRGISILEKLIKTCPVWLQLSLGQAEVAR
ILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSALVFED
IFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSLNPPQERGKPAE
PPRDQAPGFPQVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFIEDCSSALPTDQPPLG
SCPARPLPPTSDTTSPTSRWAPRRPPPPPPVLPLQPSSPAQPPLLPASAPAPACPLPTSP
PVPAPVTPHAPGPPDHPSQPPMTACERLPCPTAGLGPLREEAMKPGAASSPLQQASPPPL
PTKKNLPTAPPRRRVSERVSLEDQSPGMAAEGAQLSLPPQGTSDSPEDTPRGSTEQGQDT
EVKASDPDSMPELPRKAKQPPVPPPRKKRISRQLASTLPAPLENAELCTQAMALETPTPG
PPREGQSPASQAGTQHPQAQATAHSQSSSEFKGSLASLSDSLGASVMATDQDSYSTSSTE
EELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRKLYKKVVELAQDKASYF
GSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELE
AIVESALYKCVLKPLKEAINSCLHEITARTSLQQLKETSSDLAHTLXXXXXXXVPMMEKI
LQKFASMHKAYSPEKKISILLKTCKLIYDSMALGNPGQRAAGRGLGEELSFYGSMTPP
Download sequence
Identical sequences 9544.ENSMMUP00000018350 ENSMMUP00000018350 ENSMMUP00000018350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]